ABCC2 p.Thr1543Ala
[switch to full view]Comments [show]
None has been submitted yet.
PMID: 11952788
[PubMed]
Nies AT et al: "Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2)."
No.
Sentence
Comment
138
We therefore deleted the C-terminal three amino acids or substituted threonine with alanine at position 1543.
X
ABCC2 p.Thr1543Ala 11952788:138:69
status: NEW158 Asacontrol,localizationofGFP-MRP2,GFP-MRP2D3, and GFP-MRP2-T1543A was also analyzed in MDCKII cells grown polarized on Transwell filter membranes (Fig. 6).
X
ABCC2 p.Thr1543Ala 11952788:158:59
status: NEW160 GFP-MRP2, GFP-MRP2D3, and GFP-MRP2-T1543A were almost exclusively present in the apical membrane with some GFP fluorescence also present in intracellular compartments.
X
ABCC2 p.Thr1543Ala 11952788:160:35
status: NEW192 Because HepG2 cells endogenously Table 1. Quantitative analysis of the subcellular localization of C-terminally mutated GFP-MRP2 constructs in polarized HepG2 cells. Data are percentages of cells in which the respective localization of recombinant protein was observed as described in Materials and methods. Cells were observed 2 days after transfection. Data are means ±SD of six transient transfections using butyrate-induced cells as described under Materials and methods. Construct % Apical % Vesicles % ER C-Terminal sequence (1516-1545) GFP-MRP2 73 ± 9 18 ± 9 9 ± 5 GSPEELLQIPGPFYFMAKEAGIENVNSTKF GFP-MRP2D3 64 ± 9 13 ± 5 23 ± 9 GSPEELLQIPGPFYFMAKEAGIENVNS GFP-MRP2-T1543A 67 ± 6 16 ± 2 17 ± 6 GSPEELLQIPGPFYFMAKEAGIENVNSAKF GFP-MRP2D15 16 ± 7 17 ± 7 67 ± 14 GSPEELLQIPGPFYF GFP-MRP2D15TKF 21 ± 11 21 ± 7 58 ± 11 GSPEELLQIPGPFYFTKF Fig. 6.
X
ABCC2 p.Thr1543Ala 11952788:192:707
status: NEW193 Localization of GFP-MRP2 (green in A,B), GFP-MRP2D3 (green in C,D), and GFP-MRP2-T1543A (green in E,F) in polarized MDCKII cells.
X
ABCC2 p.Thr1543Ala 11952788:193:81
status: NEW197 The intense yellow color in the x-z planes, due to merging of the green GFP and the red concanavalin A fluorescence, shows that GFP-MRP2, GFP-MRP2D3, and GFP-MRP2-T1543A are almost exclusively localized in the apical membrane.
X
ABCC2 p.Thr1543Ala 11952788:197:163
status: NEW
PMID: 11274200
[PubMed]
Harris MJ et al: "Identification of the apical membrane-targeting signal of the multidrug resistance-associated protein 2 (MRP2/MOAT)."
No.
Sentence
Comment
97
The T1543A and K1544A mutants had both apical and basolateral targeting (nonpolarized distribution) with an increase in protein accumulation in intracellular vesicles.
X
ABCC2 p.Thr1543Ala 11274200:97:4
status: NEW109 A, the T1543A mutation produced a nonpolarized distribution of the fusion protein.
X
ABCC2 p.Thr1543Ala 11274200:109:7
status: NEW162 The T1543A mutant did produce a change in targeting compared with the native protein, allowing both basolateral and apical targeting, i.e. nonpolarized targeting, and also an increased accumulation in vesicles, suggesting some instability in the targeting mechanism.
X
ABCC2 p.Thr1543Ala 11274200:162:4
status: NEW